From klewellen at shellworld.net Tue Nov 1 11:34:06 2022 From: klewellen at shellworld.net (Karen Lewellen) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] two Alpine config questions? In-Reply-To: <8ff56ba7-37d7-dc30-06cb-7fac9dc1f548@telefonica.net> References: <2ba32369-de05-11f5-b448-8d608b946429@gmail.com> <82233959-963d-2d98-4a9b-cb800399c6a@gmail.com> <45E056FD-4901-4845-BD37-D85332D840DC@apple.com> <549935f3-26bb-7d02-f672-dd80b6b54779@telefonica.net> <2e128e1-3597-a49b-2c5e-1fa9b6c62e@gmail.com> <8ff56ba7-37d7-dc30-06cb-7fac9dc1f548@telefonica.net> Message-ID: Hi all, My direct access to alpine is provided by dreamhost, as a part of their shared user account workspace. What this means is not everything flows as one might expect, but I am hoping there is a simple configuration choice I can reach. When one wishes to add an email to your contacts, the take email feature allows you to, at least in my experience elsewhere, add an email to your address book. For some reason though, this often fails when I do this from our Alpine setup for our office email. It works most often, but fails from time to time. Is there a specific feature in settings that configures this option? On a different note, is there a way to combine folders in alpine? Thanks, Karen Lewellen From mattack at apple.com Tue Nov 1 12:02:56 2022 From: mattack at apple.com (Matt Ackeret) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] two Alpine config questions? In-Reply-To: References: <2ba32369-de05-11f5-b448-8d608b946429@gmail.com> <82233959-963d-2d98-4a9b-cb800399c6a@gmail.com> <45E056FD-4901-4845-BD37-D85332D840DC@apple.com> <549935f3-26bb-7d02-f672-dd80b6b54779@telefonica.net> <2e128e1-3597-a49b-2c5e-1fa9b6c62e@gmail.com> <8ff56ba7-37d7-dc30-06cb-7fac9dc1f548@telefonica.net> Message-ID: > On Nov 1, 2022, at 11:34 AM, Karen Lewellen wrote: > On a different note, is there a way to combine folders in alpine? I have no idea about the first question, but the "workaround" for this is just to go into the folder you want to get rid of, select all (which may mean you have to turn on aggregate commands) and save all of the messages into the OTHER folder.. then after confirming everything is there (just to be paranoid), delete the original folder. and this will end up with the moved folder's messages all 'after' the original folder's messages.. so if you want to have them all in arrival order, sort the folder by arrival order, select all and I think you can then save them all to the same folder (which will duplicate them, but they'll be in the arrival order for example, regardless of which mailbox they originally came from). then expunge, which will delete the 'extra' copy of each message. From lucio at lambrate.inaf.it Wed Nov 2 12:33:46 2022 From: lucio at lambrate.inaf.it (Lucio Chiappetti) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] two Alpine config questions? In-Reply-To: References: Message-ID: On Tue, 1 Nov 2022, Matt Ackeret wrote: >> On a different note, is there a way to combine folders in alpine? IF they are LOCAL folders (not IMAP) and are in the plain Unix format, one can just concatenate the folder files (eventually getting rid of the "dummy first message" which Alpine may prepend) from the shell. > the "workaround" for this is just to go into the folder you want to get > rid of, select all (which may mean you have to turn on aggregate > commands) and save all of the messages into the OTHER folder.. Yes,. aggregate commands are VERY useful for any more or less clever manipulation of groups of messages. Even with manual selection, or selection by date or number range. For instance in my inbox I keep only "pending messages" to be dealt with, and every so and often I reorder them by hand grouping them "by category" (I use dummy empty messages with a specific subject as placeholder-separators, with a specific colour coding). Or once a year, I move MOST of the message from a topic folder xxxx to an archive folder Old-yyyy/xxxx-yyyy, and keep only the most iportant and still applicable in xxxx. > and this will end up with the moved folder's messages all 'after' the > original folder's messages.. so if you want to have them all in arrival > order, sort the folder by arrival order, select all and I think you can > then save them all to the same folder (which will duplicate them, Or just select them manually or by range. I do this when I move a dealt-with message fromm inbox to a topic folder, and it gets there "our of chronological order". > then expunge, which will delete the 'extra' copy of each message. What tou say assumes, I presume, that saving a message marks it for deletion. In my configuration this is NOT the default (by purpose). My sequence when I do a re-ordering is: - select the messages to be moved at the end - do A S to aggregate-save them (even to the same folder) - do A D to aggregate-delete the original selection (in my colour coding the messages turn blue) - press return or down-arrow to update the index listing on the screen (this is MY "paranoid verification", I see both the blue deleted and coral moved messages) - then X to expunge Alpine is very flexible and allows you to do almost verything you want ! From superaorta at gmail.com Mon Nov 7 02:20:37 2022 From: superaorta at gmail.com (superaorta@gmail.com) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] forward over answer etc In-Reply-To: References: <1656599708.cJOVAafXjk@lunesta> Message-ID: <1832716.tdWV9SEqCh@lunesta> If I answer a message I get the "A" flag. If I forward a message I the the "F" flag. If I do both I just get "F". Is there an easy way to display "FA" - there seems to be space on the screen for this. If not is there an easy way to view the flags? Ta From lucio at lambrate.inaf.it Mon Nov 7 12:24:00 2022 From: lucio at lambrate.inaf.it (Lucio Chiappetti) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] forward over answer etc In-Reply-To: <1832716.tdWV9SEqCh@lunesta> References: <1832716.tdWV9SEqCh@lunesta> Message-ID: -- 'It seemed to me,' said Wonko the Sane, 'that any civilization that had so far lost its head as to need to include a set of detailed instructions for use in a package of toothpicks, was no longer a civilization in which I could live and stay sane.' Douglas Adams, So Long, and Thanks for All the Fish From lucio at lambrate.inaf.it Mon Nov 7 12:36:55 2022 From: lucio at lambrate.inaf.it (Lucio Chiappetti) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] forward over answer etc In-Reply-To: <1832716.tdWV9SEqCh@lunesta> References: <1832716.tdWV9SEqCh@lunesta> Message-ID: On Mon, 7 Nov 2022, superaorta@gmail.com wrote: > Is there an easy way to display "FA" - there seems to be space on the > screen for this. Go in the configuration screen (M S C) Search for Index Format Press ? for help Look for "The list of available tokens is here." anc click on here. Look for the tokens called STATUS and FULLSTATUS. I report only the first lines of each STATUS This token represents a three character wide field displaying various aspects of the message's state. FULLSTATUS This token represents a less abbreviated alternative to the "STATUS" token. It is six characters wide. I personally have FULLSTATUS. I do not care much for the A and F flags, but have a set of flags of my own, associated with special colours. FULLSTATUS should do sort of what you want. -- 'It seemed to me,' said Wonko the Sane, 'that any civilization that had so far lost its head as to need to include a set of detailed instructions for use in a package of toothpicks, was no longer a civilization in which I could live and stay sane.' Douglas Adams, So Long, and Thanks for All the Fish From superaorta at gmail.com Mon Nov 7 14:52:58 2022 From: superaorta at gmail.com (superaorta@gmail.com) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] forward over answer etc In-Reply-To: References: <1832716.tdWV9SEqCh@lunesta> Message-ID: <3197100.aeNJFYEL58@lunesta> Ok - I managed that but it hasn't achieved what I want... I can now no longer tell if something has been forwarded, since the forward flag doesn't seem to be displayed in FULLSTATUS. I wouldn't rule out me doing something stupid but this seems to be consistent with the help description... On Monday, 7 November 2022 20:36:55 GMT Lucio Chiappetti wrote: > On Mon, 7 Nov 2022, superaorta@gmail.com wrote: > > > Is there an easy way to display "FA" - there seems to be space on the > > screen for this. > > Go in the configuration screen (M S C) > Search for Index Format > Press ? for help > Look for "The list of available tokens is here." anc click on here. > > Look for the tokens called STATUS and FULLSTATUS. I report only the first > lines of each > > STATUS > This token represents a three character wide field displaying various > aspects of the message's state. > > FULLSTATUS > This token represents a less abbreviated alternative to the "STATUS" > token. It is six characters wide. > > I personally have FULLSTATUS. I do not care much for the A and F flags, > but have a set of flags of my own, associated with special colours. > > FULLSTATUS should do sort of what you want. > > From olaf at kravcenko.com Mon Nov 7 22:38:12 2022 From: olaf at kravcenko.com (Olaf Skibbe) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] forward over answer etc In-Reply-To: <3197100.aeNJFYEL58@lunesta> References: <1832716.tdWV9SEqCh@lunesta> <3197100.aeNJFYEL58@lunesta> Message-ID: <0bd6072a-92ce-07ca-a88a-ec928a9a010e@kravcenko.com> > On Monday, 7 November 2022 20:36:55 GMT Lucio Chiappetti wrote: >> On Mon, 7 Nov 2022, superaorta@gmail.com wrote: >> >>> Is there an easy way to display "FA" - there seems to be space on the >>> screen for this. >> >> Go in the configuration screen (M S C) >> Search for Index Format >> Press ? for help >> Look for "The list of available tokens is here." anc click on here. >> >> Look for the tokens called STATUS and FULLSTATUS. I report only the first >> lines of each >> >> STATUS >> This token represents a three character wide field displaying various >> aspects of the message's state. >> >> FULLSTATUS >> This token represents a less abbreviated alternative to the "STATUS" >> token. It is six characters wide. >> >> I personally have FULLSTATUS. I do not care much for the A and F flags, >> but have a set of flags of my own, associated with special colours. >> >> FULLSTATUS should do sort of what you want. On Mon, 7 Nov 2022 at 22:52, superaorta@gmail.com wrote: > I can now no longer tell if something has been forwarded, since the > forward flag doesn't seem to be displayed in FULLSTATUS. Which is in accordance with the description, but seems to be kind of counter-intutitiv to me (FULLSTATUS shows less than STATUS?). Neither does the flag appear with IMAPSTATUS. I am actually missing it here. Is there a way to get the forwarded flag displayed with IMAPSTATUS? Cheers, Olaf From lucio at lambrate.inaf.it Wed Nov 9 14:01:06 2022 From: lucio at lambrate.inaf.it (Lucio Chiappetti) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] deceptive links (fictitious) Message-ID: I have just received a mail message, which reports at top the indication: [The following HTML text may contain deceptive links. Carefully ] [ note the destination URL before visiting any links.] The message comes from an official site (the municipal authorities of Milan, it is the yearly notification of the garbage collection tax). This year (*) it is an HTML-only mail. It appears in alpine all underscored (this I believe it is because of tags in the source), and contains links of the form https://urldefense.com/v3/__https:/www.comune.milano.it/fascicolo-del- cittadino__;!!LQkDIss!SyDMKrF1ZGZ9NC-QEg5A3e_HMACAZ_wl0T0MsBG1UUGQPmUFWIPKcP B7l8ZiEIplfPzZj3g2mkkAvrAlR6Sqj39R$ (*) apparently even last year's message contined URLs of the same form, but was sent as an ascii message with an "identical content" HTML attachment (the version stored in my Fcc has the HTML stripped off, since I hate these double-version e-mail). Anyhow I think there are no "deceptive links". All the rest is sender's fault. -- Lucio Chiappetti From robin.listas at telefonica.net Wed Nov 9 14:22:26 2022 From: robin.listas at telefonica.net (Carlos E. R.) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] deceptive links (fictitious) In-Reply-To: References: Message-ID: <0b9a2aec-8a74-98e7-5bc5-71a4580017a1@telefonica.net> -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA1 El 2022-11-09 a las 23:01 +0100, Lucio Chiappetti escribi?: > I have just received a mail message, which reports at top the indication: > > [The following HTML text may contain deceptive links. Carefully ] > [ note the destination URL before visiting any links.] I think this means that the displayed URL is not exatly the same as the URL it goes to when clicking on the link. For example, the text may be: ?as you know, *grey cows* grace preferably on green pastures? *grey cows* is a link pointing to Well, that is a deceptive link :-) - -- Cheers, Carlos E. R. (from openSUSE 15.3 x86_64 at Telcontar) -----BEGIN PGP SIGNATURE----- iHoEARECADoWIQQZEb51mJKK1KpcU/W1MxgcbY1H1QUCY2woIhwccm9iaW4ubGlz dGFzQHRlbGVmb25pY2EubmV0AAoJELUzGBxtjUfVe6YAnAs+MDGbL5eMvegQJH5T BtaVzQ/WAJ9cG1/srA4AdaGCwtSzs5YdblOg2A== =TrIc -----END PGP SIGNATURE----- From robin.listas at telefonica.net Wed Nov 9 14:22:33 2022 From: robin.listas at telefonica.net (Carlos E. R.) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] deceptive links (fictitious) In-Reply-To: References: Message-ID: On 2022-11-09 23:01, Lucio Chiappetti wrote: > I have just received a mail message, which reports at top the indication: > > [The following HTML text may contain deceptive links.? Carefully ] > [ note the destination URL before visiting any links.] > ... > Anyhow I think there are no "deceptive links". All the rest is > sender's fault. I will try to create a deceptive link using Thunderbird. Thus, this post containst html part. deceptive link test -- Cheers / Saludos, Carlos E. R. (from 15.3 x86_64 at Telcontar) -------------- next part -------------- An HTML attachment was scrubbed... URL: -------------- next part -------------- A non-text attachment was scrubbed... Name: OpenPGP_signature Type: application/pgp-signature Size: 209 bytes Desc: OpenPGP digital signature URL: From dwm at xpasc.com Wed Nov 9 17:17:08 2022 From: dwm at xpasc.com (David Morris) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] deceptive links (fictitious) In-Reply-To: References: Message-ID: <2227f86-863-2b58-1f75-bb45faa0e545@xpasc.com> In your example, the visual text serving as an anchor probably shows: www.comune.milano.it but your URL specifies: urldefense.com That generates a deceptive URL warning because the actual server is not the server shown to the user in the visible text. FWIW, the apparent 'real' URL is missing a slash. I don't know what urldefense.com is. So at the minimum, it is probably a tracker, may do what the name implies OR it might do a 'hidden' proxy that can then examine any private information sent in the response to the resulting web page. Probably safe to copy out the embeded URL and paste than into your browser (and fix HTTP:/ to HTTP://) On Wed, 9 Nov 2022, Lucio Chiappetti wrote: > I have just received a mail message, which reports at top the indication: > > [The following HTML text may contain deceptive links. Carefully ] > [ note the destination URL before visiting any links.] > > The message comes from an official site (the municipal authorities of Milan, > it is the yearly notification of the garbage collection tax). > > This year (*) it is an HTML-only mail. It appears in alpine all underscored > (this I believe it is because of tags in the source), and contains links > of the form > > https://urldefense.com/v3/__https:/www.comune.milano.it/fascicolo-del- > cittadino__;!!LQkDIss!SyDMKrF1ZGZ9NC-QEg5A3e_HMACAZ_wl0T0MsBG1UUGQPmUFWIPKcP > B7l8ZiEIplfPzZj3g2mkkAvrAlR6Sqj39R$ > > (*) apparently even last year's message contined URLs of the same form, but > was sent as an ascii message with an "identical content" HTML attachment (the > version stored in my Fcc has the HTML stripped off, since I hate these > double-version e-mail). > > Anyhow I think there are no "deceptive links". All the rest is sender's fault. > > > -- > Lucio Chiappetti > _______________________________________________ > Alpine-info mailing list > Alpine-info@u.washington.edu > http://mailman12.u.washington.edu/mailman/listinfo/alpine-info > > ---------- > > This email has been scanned for spam and viruses by Proofpoint Essentials. > Visit the following link to report this email as spam: > https://us3.proofpointessentials.com/index01.php?mod_id=11&mod_option=logitem&mail_id=1668031521-AhN2mMV7bbuk&r_address=dwm%40xpasc.com&report=1 > From andrew at aitchison.me.uk Thu Nov 10 09:18:29 2022 From: andrew at aitchison.me.uk (Andrew C Aitchison) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] deceptive links (fictitious) In-Reply-To: <2227f86-863-2b58-1f75-bb45faa0e545@xpasc.com> References: <2227f86-863-2b58-1f75-bb45faa0e545@xpasc.com> Message-ID: <0fe5db81-65b9-5085-e5f1-028cf01cb4b7@aitchison.me.uk> On Wed, 9 Nov 2022, David Morris wrote: > In your example, the visual text serving as an anchor probably shows: > www.comune.milano.it > but your URL specifies: > urldefense.com > That generates a deceptive URL warning because the actual server is not > the server shown to the user in the visible text. FWIW, the apparent > 'real' URL is missing a slash. > > I don't know what urldefense.com is. So at the minimum, it is probably a > tracker, may do what the name implies OR it might do a 'hidden' proxy that > can then examine any private information sent in the response to the > resulting web page. It is an enterprise protection tool from proofpoint. Every link starting with 'urldefense.proofpoint.com' is part of the TAP system. This checks that websites are safe to visit, with no malware. If the site is deemed safe by Proofpoint, your browser will redirect you to the original URL web destination. If the site is hosting malware, TAP will block users from accessing the malicious site. For more details, please visit our website at www.proofpoint.com I put display-filters=urldefense.proofpoint script to strip out what profpoint added to the URL> into my .pinerc > Probably safe to copy out the embeded URL and paste than into your browser > (and fix HTTP:/ to HTTP://) > > On Wed, 9 Nov 2022, Lucio Chiappetti wrote: > >> I have just received a mail message, which reports at top the indication: >> >> [The following HTML text may contain deceptive links. Carefully ] >> [ note the destination URL before visiting any links.] >> >> The message comes from an official site (the municipal authorities of Milan, >> it is the yearly notification of the garbage collection tax). >> >> This year (*) it is an HTML-only mail. It appears in alpine all underscored >> (this I believe it is because of tags in the source), and contains links >> of the form >> >> https://urldefense.com/v3/__https:/www.comune.milano.it/fascicolo-del- >> cittadino__;!!LQkDIss!SyDMKrF1ZGZ9NC-QEg5A3e_HMACAZ_wl0T0MsBG1UUGQPmUFWIPKcP >> B7l8ZiEIplfPzZj3g2mkkAvrAlR6Sqj39R$ >> >> (*) apparently even last year's message contined URLs of the same form, but >> was sent as an ascii message with an "identical content" HTML attachment (the >> version stored in my Fcc has the HTML stripped off, since I hate these >> double-version e-mail). >> >> Anyhow I think there are no "deceptive links". All the rest is sender's fault. >> >> >> -- >> Lucio Chiappetti >> _______________________________________________ >> Alpine-info mailing list >> Alpine-info@u.washington.edu >> http://mailman12.u.washington.edu/mailman/listinfo/alpine-info >> >> ---------- >> >> This email has been scanned for spam and viruses by Proofpoint Essentials. >> Visit the following link to report this email as spam: >> https://us3.proofpointessentials.com/index01.php?mod_id=11&mod_option=logitem&mail_id=1668031521-AhN2mMV7bbuk&r_address=dwm%40xpasc.com&report=1 >> > _______________________________________________ > Alpine-info mailing list > Alpine-info@u.washington.edu > http://mailman12.u.washington.edu/mailman/listinfo/alpine-info > -- Andrew C. Aitchison Kendal, UK andrew@aitchison.me.uk From dwm at xpasc.com Fri Nov 11 15:06:49 2022 From: dwm at xpasc.com (David Morris) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] A couple feature requests Message-ID: <18347eb-a2e4-3e88-eb58-73b239d7872b@xpasc.com> 1. Whenever I enter a file name which is broken ... re-enable the entry field so I can edit and fix the error. 2. When replying to an email from within a folder other than INBOX) for which the sender doesn't have an FCC in the address book, prefill the FCC field with the folder containing the replyed to email From superaorta at gmail.com Sun Nov 13 09:20:43 2022 From: superaorta at gmail.com (superaorta@gmail.com) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] forward over answer etc In-Reply-To: <0bd6072a-92ce-07ca-a88a-ec928a9a010e@kravcenko.com> References: <1832716.tdWV9SEqCh@lunesta> <3197100.aeNJFYEL58@lunesta> <0bd6072a-92ce-07ca-a88a-ec928a9a010e@kravcenko.com> Message-ID: <8140241.T7Z3S40VBb@lunesta> So neither STATUS or FULLSTATUS will show both F and A flags. Is there any (easy) way to view this information? it doesn't appear in the message display either and switching between the two views is (politely) clunky... On Tuesday, 8 November 2022 06:38:12 GMT Olaf Skibbe wrote: > > On Monday, 7 November 2022 20:36:55 GMT Lucio Chiappetti wrote: > >> On Mon, 7 Nov 2022, superaorta@gmail.com wrote: > >> > >>> Is there an easy way to display "FA" - there seems to be space on the > >>> screen for this. > >> > >> Go in the configuration screen (M S C) > >> Search for Index Format > >> Press ? for help > >> Look for "The list of available tokens is here." anc click on here. > >> > >> Look for the tokens called STATUS and FULLSTATUS. I report only the first > >> lines of each > >> > >> STATUS > >> This token represents a three character wide field displaying various > >> aspects of the message's state. > >> > >> FULLSTATUS > >> This token represents a less abbreviated alternative to the "STATUS" > >> token. It is six characters wide. > >> > >> I personally have FULLSTATUS. I do not care much for the A and F flags, > >> but have a set of flags of my own, associated with special colours. > >> > >> FULLSTATUS should do sort of what you want. > > On Mon, 7 Nov 2022 at 22:52, superaorta@gmail.com wrote: > > > I can now no longer tell if something has been forwarded, since the > > forward flag doesn't seem to be displayed in FULLSTATUS. > > Which is in accordance with the description, but seems to be kind of > counter-intutitiv to me (FULLSTATUS shows less than STATUS?). Neither > does the flag appear with IMAPSTATUS. I am actually missing it here. Is > there a way to get the forwarded flag displayed with IMAPSTATUS? > > Cheers, > Olaf > _______________________________________________ > Alpine-info mailing list > Alpine-info@u.washington.edu > http://mailman12.u.washington.edu/mailman/listinfo/alpine-info > From alpine.chappa at yandex.com Sun Nov 13 12:27:09 2022 From: alpine.chappa at yandex.com (Eduardo Chappa) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] forward over answer etc In-Reply-To: <8140241.T7Z3S40VBb@lunesta> References: <1832716.tdWV9SEqCh@lunesta> <3197100.aeNJFYEL58@lunesta> <0bd6072a-92ce-07ca-a88a-ec928a9a010e@kravcenko.com> <8140241.T7Z3S40VBb@lunesta> Message-ID: On Sun, 13 Nov 2022, superaorta@gmail.com wrote: > So neither STATUS or FULLSTATUS will show both F and A flags. Is there > any (easy) way to view this information? it doesn't appear in the > message display either and switching between the two views is (politely) > clunky... Only the STATUS token allows you to display the "F"orwarded status. If the message has been replied to, it will show the "A"nswered flag, and if it has been marked deleted it will show the "D"eleted flag. The only way in which you can see the forwarded status is if you have not flagged in any of the other ways. Neither FULLSTATUS or any of the *IMAPSTATUS tokens allow you to see the "F"orwarded flag in the index (I do not know why) but if you have marked a message "F"orwarded and have not replied to it or marked it deleted, you can see the "FWD" status at the top right of the screen, in the titlebar. -- Eduardo From lucio at lambrate.inaf.it Sun Nov 13 13:17:28 2022 From: lucio at lambrate.inaf.it (Lucio Chiappetti) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] forward over answer etc In-Reply-To: <8140241.T7Z3S40VBb@lunesta> References: <8140241.T7Z3S40VBb@lunesta> Message-ID: On Sun, 13 Nov 2022, superaorta@gmail.com wrote: > So neither STATUS or FULLSTATUS will show both F and A flags. Is there > any (easy) way to view this information? Sincerely I've always considered those flags as uninteresting, particularly the F one. But *perhaps* you could force a message with pone of those flags to appear in a particular colour. Chech the help of M S C Patterns Indexcolors I have a personal colour coding for messages addressed to me (pattern on a list of To addresses), to those with some CUSTOM flags (K,I,S the latter is a flag I assign to messagers in the inobxc I've already saved to another folder but are "still pending" ... as well as for messages which are New, Deleted or Important ... the latter three are controlled by variables STATN, STATD? etc. Maybe there are variables for what you need ? Good luck ! From pierre.frenkiel at gmail.com Tue Nov 22 10:18:23 2022 From: pierre.frenkiel at gmail.com (Pierre Frenkiel) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] sending mail Message-ID: when I said that I have no problem with thunderbird, that means that the mails I send with it actually reach their target! It's all what I need. It's generally admitted that when the theory doesn't match the facts, it's the theory which is wrong. don't you agree? cheers, Pierre Frenkiel -------------- next part -------------- From MAILER-DAEMON Tue Nov 22 19:09:25 2022 Date: 22 Nov 2022 19:09:25 +0100 From: Mail System Internal Data Subject: DON'T DELETE THIS MESSAGE -- FOLDER INTERNAL DATA Message-ID: <1669140565@gmail.com> X-IMAP: 1669140565 0000000001 Status: RO This text is part of the internal format of your mail folder, and is not a real message. It is created automatically by the mail system software. If deleted, important folder data will be lost, and it will be re-created with the data reset to initial values. From MAILER_DAEMON Wed Oct 12 11:18:01 2022 Return-Path: Delivered-To: unknown Received: from imap.laposte.net (160.92.124.65:143) by pfr2 with IMAP4; 12 Oct 2022 09:18:01 -0000 Received: from mlpnf0101.laposte.net (mlpnf0101.sys.meshcore.net [10.94.128.80]) by mlpnb0510 with LMTPA; Wed, 12 Oct 2022 11:15:03 +0200 X-Cyrus-Session-Id: cyrus-207605-1665566103-3-14397601018499167458 X-Sieve: CMU Sieve 3.0 ARC-Seal: i=2; a=rsa-sha256; d=laposte.net; s=lpn-wlmd; t=1665566103; cv=pass; b=Qpm6Y6435JIKcvByC3KWpnzcD8vE8v/8kqggQ1RMOIykKisPDiSsfk91IdF2JOTBHRXnbwnNPpZ Jp6t7bsHERMPlN2N/JoNFDEei4sMT5qANpk43iiR6I/ZtTpDb9nebWSCuM1vzeSzfgK6CItgHeDe CXp73Ywgjk1abxx1Y8HB3k3TiWHmWr/xjLaSKtoc6ntn18G5F1hlmP+1PwTPXwLc8j0N3v3Fcbsc JZajDu2EOUfA0jQ9BfUk+ZAH5JEge02l5KoS/wwkNImfQrcn7K8eLlGn996HREDPhIECIl6+GEii +EShMPl/RX6s9JWIQCsFBMQS0NT1J08egRdI/fg== ARC-Message-Signature: i=2; a=rsa-sha256; c=simple/simple; d=laposte.net; s=lpn-wlmd; t=1665566103; h=Date:To:References:From:In-Reply-To:Subject:List-Id: List-Unsubscribe:List-Archive:List-Post:List-Help:List-Subscribe; bh=sQk6Iow MFKXBr2Hlh2dIhqj26rmeeUflERqZ1XIhS0g=; b=E4/QEN6kXAxR9CbZ30pjit1rsYTyvKH672t Dv2SC0UNa5UcnqnmPA5DYCkw3rqFk3uNmdNOiQD0eYsQD/RbpMkk/iOnRQswvOd7Od8xBq4881sC UaVcn5Eoh/CRpcNfz7ePEETfBEwoMd1ffG/bGIt+jw9y6UuJ0dvMTKsu0YqlPfNQ59fgqb8fL/TH wnRXnyrdM9SXEcvDWciQ6sEGnJY7tDi0hxjPfWK81VdafsLJvvN4/mIfeJjZmaonViJR+Z6P8/Da hKifbR1WLodqnf6vhnT9pAptfd63n94mYt9X4wwh7LOO5afTn6qPIxBl901ESb1EQ5lu0IBYsJ5E 3GQ== ARC-Authentication-Results: i=2; laposte.net; spf=pass smtp.helo=mail-pl1-f179.google.com smtp.mailfrom=pierre.frenkiel+caf_=p.frenkiel=laposte.net@gmail.com; dkim=none; dmarc=fail reason="SPF is not aligned, DKIM is not aligned"; arc=pass header.oldest-pass=0 smtp.remote-ip=209.85.214.179; bimi=skipped reason="non-pass DMARC" X-mail-filterd: {"version":"1.5.1","queueID":"4MnRnM3cqPz1BFLs","contextId":"513bc92d-f580-4d0b-9293-1f1af689c15d"} X-ppbforward: {"queueID":"4MnRnM3cqPz1BFLs","server":"mlpnf0101"} Received: from outgoing-mail.laposte.net (localhost.localdomain [127.0.0.1]) by mlpnf0101.laposte.net (SMTP Server) with ESMTP id 4MnRnM3cqPz1BFLs for ; Wed, 12 Oct 2022 11:15:03 +0200 (CEST) X-mail-filterd: {"version":"1.5.1","queueID":"4MnRnM05fjz1BFM0","contextId":"cb48a51d-a31a-4204-9e28-f62ca2d81892"} X-lpn-mailing: LEGIT X-lpn-spamrating: 40 X-lpn-spamlevel: not-spam Authentication-Results: laposte.net; spf=pass smtp.mailfrom=pierre.frenkiel+caf_=p.frenkiel=laposte.net@gmail.com smtp.helo=mail-pl1-f179.google.com; dkim=none; dmarc=fail reason="SPF is not aligned, DKIM is not aligned"; arc=pass smtp.remote-ip=209.85.214.179 header.oldest-pass=0; bimi=skipped reason="non-pass DMARC" X-List-Unsubscribe: , X-lpn-spamcause: OK, (0)(0000)gggruggvucftvghtrhhoucdtuddrgedvfedrfeejkedgudegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecunfetrffquffvgfdpggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucenucfjughrpefkffggfgfvfhfhjgfuphejjfegudeftdgtvghssehmtderredtfeejnecuhfhrohhmpedfvegrrhhlohhsucfgrdcutfdrfdcuoehrohgsihhnrdhlihhsthgrshesthgvlhgvfhhonhhitggrrdhnvghtqeenucggtffrrghtthgvrhhnpeefvddvveeiiefggfeugfeljefggeegueejueettdehueegleetudejveefteevhfenucffohhmrghinhepfihikhhiphgvughirgdrohhrghenucfkphepvddtledrkeehrddvudegrddujeelpdejledrudehtddrudduledrvddukeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddugedrudejledphhgvlhhopehmrghilhdqphhluddqfhdujeelrdhgohhoghhlvgdrtghomhdpmhgrihhlfhhrohhmpehpihgvrhhrvgdrfhhrvghnkhhivghlodgtrghfpgepphdrfhhrvghnkhhivghlpehlrghpohhsthgvrdhnvghtsehgmhgrihhlrdgtohhmpdhnsggprhgtphhtthhopedupdhrtghpthhtohepphdrfhhrvghnkhhivghlsehlrghpohhsthgvrdhnvghtpdhsphhfpehprghsshdpughkihhmpehnohhnvg Received: from mail-pl1-f179.google.com (mail-pl1-f179.google.com [209.85.214.179]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0101.laposte.net (SMTP Server) with ESMTPS id 4MnRnM05fjz1BFM0 for ; Wed, 12 Oct 2022 11:15:02 +0200 (CEST) Received: by mail-pl1-f179.google.com with SMTP id c24so15713525plo.3 for ; Wed, 12 Oct 2022 02:15:02 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=sender:errors-to:list-subscribe:list-help:list-post:list-archive :list-unsubscribe:list-id:precedence:subject:in-reply-to:from :references:to:content-language:user-agent:mime-version:date :message-id:delivered-to:x-gm-message-state :x-original-authentication-results:from:to:cc:subject:date :message-id:reply-to; bh=sQk6IowMFKXBr2Hlh2dIhqj26rmeeUflERqZ1XIhS0g=; b=codweAZ5MJSqWyQRdxH67DXiq+0WNG/Gmvj+rW5Mcho/BvWlmQDwBaGHBNSw1Gv09t gRYW9iPFTS1eCUPia1u2qrAHNesZK5v/d0A0cmYS8EhZv0olhmjiI2edQfsPNJtyUkhi /SHzclzDdyah0ejH0kqPDHWy0ONKipbXWvTsq6pRvI8NzNn13k6dHzPLJaKKv5VCSYzI j9rSbewregfRKfZRgPSG7MZBW1XxidmZVj5GCoKNY6iPF1DPhYadSNpVjVO/uLfQISRf Cct+y88ZgpmEQ+HnPbyLLrQz4hVXws8XBQfI2jxnNAA/DUlWhxbvY9rSjIcZdDsl7VPP 1Xqg== X-Original-Authentication-Results: mx.google.com; spf=pass (google.com: domain of alpine-info-bounces@mailman12.u.washington.edu designates 205.220.177.146 as permitted sender) smtp.mailfrom=alpine-info-bounces@mailman12.u.washington.edu; dmarc=fail (p=NONE sp=NONE dis=NONE) header.from=telefonica.net X-Gm-Message-State: ACrzQf3QPDNkzffrbWGGkbTft49DFbcHRyAt0akOjzc7nI+xf2gS6es3 qCbe0w8ge/B/rra2HY1lEjLzTW+4qET1Yrt9mne5nMI3cu3MdiHsDg== X-Received: by 2002:a17:90b:811:b0:20b:16ca:2abc with SMTP id bk17-20020a17090b081100b0020b16ca2abcmr4051851pjb.163.1665566101757; Wed, 12 Oct 2022 02:15:01 -0700 (PDT) X-Forwarded-To: p.frenkiel@laposte.net X-Forwarded-For: pierre.frenkiel@gmail.com p.frenkiel@laposte.net Delivered-To: pierre.frenkiel@gmail.com Received: by 2002:a17:522:3dc5:b0:482:9388:fe3 with SMTP id a5csp1376953pvm; Wed, 12 Oct 2022 02:14:59 -0700 (PDT) X-Google-Smtp-Source: AMsMyM43SRqgBhAZVeI78YF3f128II/XPpGNvaWCrqgBFpGUjqWHt0jZEbFLM5JeY9CuS37HknPk X-Received: by 2002:a0d:dc83:0:b0:360:ddcc:f6f2 with SMTP id f125-20020a0ddc83000000b00360ddccf6f2mr11466269ywe.179.1665566098627; Wed, 12 Oct 2022 02:14:58 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1665566098; cv=none; d=google.com; s=arc-20160816; b=Hh0EB+DS/9TwdV8EQW5CscDEC7eKEAVr5R8nZH1qUPgzWJpJgO9SEq6zNq+/elLJ7l 76KLpSl+E5gp8kJM3Bux0oikw1qZunr6eeb1vZOY2bEawVgp32XlUppAx3xRIiisqkHJ hkfCG0eibkXr9WpPe1vpa5wwcS5M168WQj8LEW63SPKZkEioRgCj1/+upRkzWvE5jz+K LH0Lu/8bVjzwYbKuXeCzMbP8xJxI25+ihN9mTpuxNqzgcXBRRtiIPnDKMKhIpP9zkgCM SZacPy93i++UPyD+my4NRefXPWskyYqH7o91y0109U4f7xqmsmpyY0LcAS++tI2fJDak IQPw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=sender:errors-to:list-subscribe:list-help:list-post:list-archive :list-unsubscribe:list-id:precedence:subject:in-reply-to:from :references:to:content-language:user-agent:mime-version:date :message-id; bh=sQk6IowMFKXBr2Hlh2dIhqj26rmeeUflERqZ1XIhS0g=; b=Br6saARNqa5nCLEyMGDNbE57bwoAwGreXuHcsfGlnS9QRhfpmMhS0oHfZJ4+WWO715 xdfnBqhiazdQ2Xngq5V3aXpcb0hEJ/kUvMvM/Wr/D49tgQYM0nss2+yxBymQXom4q4kM H38jK7YxQENHCHnKzSkoATbScB4MKEFIZR8KfIlXVlpw2YzuAg/g5v5RZfY9b+oSI6wR YgsT9wWUBFwj6j13YVikilTBwloGLXjVe2IrQ7usYOQhu3u3W/8MndqoVLkbC6ajTgYT WBLe/F2AEPk/33Xsux51LkEVy8SDnuqfxe1K3nVH7v30Qg3ZABdbO1SK+06DQw8UFyPa QRWQ== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of alpine-info-bounces@mailman12.u.washington.edu designates 205.220.177.146 as permitted sender) smtp.mailfrom=alpine-info-bounces@mailman12.u.washington.edu; dmarc=fail (p=NONE sp=NONE dis=NONE) header.from=telefonica.net Received: from mx0b-00641c01.pphosted.com (mx0b-00641c01.pphosted.com. [205.220.177.146]) by mx.google.com with ESMTPS id m205-20020a2558d6000000b006bfd5966941si11265573ybb.57.2022.10.12.02.14.58 (version=TLS1_2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128/128); Wed, 12 Oct 2022 02:14:58 -0700 (PDT) Received-SPF: pass (google.com: domain of alpine-info-bounces@mailman12.u.washington.edu designates 205.220.177.146 as permitted sender) client-ip=205.220.177.146; Authentication-Results: mx.google.com; spf=pass (google.com: domain of alpine-info-bounces@mailman12.u.washington.edu designates 205.220.177.146 as permitted sender) smtp.mailfrom=alpine-info-bounces@mailman12.u.washington.edu; dmarc=fail (p=NONE sp=NONE dis=NONE) header.from=telefonica.net Received: from pps.filterd (m0247479.ppops.net [127.0.0.1]) by mx0a-00641c01.pphosted.com (8.17.1.5/8.17.1.5) with ESMTP id 29C8q6LA002586; Wed, 12 Oct 2022 09:14:58 GMT Received: from mxout24.cac.washington.edu (mxout24.cac.washington.edu [140.142.234.158]) by mx0a-00641c01.pphosted.com (PPS) with ESMTPS id 3k5fvyk9n6-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT); Wed, 12 Oct 2022 09:14:57 +0000 Received: from mailman12.u.washington.edu (mailman12.u.washington.edu [69.91.245.2]) by mxout24.cac.washington.edu (8.14.4+UW20.07/8.14.4+UW22.04) with ESMTP id 29C9EomI013375 (version=TLSv1/SSLv3 cipher=DHE-RSA-AES256-GCM-SHA384 bits=256 verify=NO); Wed, 12 Oct 2022 02:14:50 -0700 Received: from mailman12.u.washington.edu (localhost [127.0.0.1]) by mailman12.u.washington.edu (8.14.4+UW20.07/8.14.4+UW22.04) with ESMTP id 29C9Enj5014556; Wed, 12 Oct 2022 02:14:50 -0700 Received: from mx0b-00641c01.pphosted.com (mx0b-00641c01.pphosted.com [205.220.177.146]) by mailman12.u.washington.edu (8.14.4+UW20.07/8.14.4+UW22.04) with ESMTP id 29C9Em2v014548 for ; Wed, 12 Oct 2022 02:14:48 -0700 Received: from pps.filterd (m0247477.ppops.net [127.0.0.1]) by mx0a-00641c01.pphosted.com (8.17.1.5/8.17.1.5) with ESMTP id 29C9BZad032341 for ; Wed, 12 Oct 2022 09:14:48 GMT Received: from relayout02-q02.e.movistar.es (relayout02-q02.e.movistar.es [86.109.101.152]) by mx0a-00641c01.pphosted.com (PPS) with ESMTPS id 3k57qs024j-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT) for ; Wed, 12 Oct 2022 09:14:47 +0000 Received: from relayout02-redir.e.movistar.es (unknown [86.109.101.202]) by relayout02-out.e.movistar.es (Postfix) with ESMTP id 4MnRn23317zhb9N for ; Wed, 12 Oct 2022 11:14:46 +0200 (CEST) Received: from Telcontar.valinor (218.red-79-150-119.dynamicip.rima-tde.net [79.150.119.218]) (using TLSv1.2 with cipher ADH-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) (Authenticated sender: robin.listas2@telefonica.net) by relayout02.e.movistar.es (Postfix) with ESMTPSA id 4MnRn21TfRzdZQc for ; Wed, 12 Oct 2022 11:14:45 +0200 (CEST) Received: from localhost (localhost [127.0.0.1]) by Telcontar.valinor (Postfix) with ESMTP id 68F6D32429C for ; Wed, 12 Oct 2022 11:14:45 +0200 (CEST) X-Virus-Scanned: amavisd-new at valinor Received: from Telcontar.valinor ([127.0.0.1]) by localhost (telcontar.valinor [127.0.0.1]) (amavisd-new, port 10024) with LMTP id lOEdYwyRLkWW for ; Wed, 12 Oct 2022 11:14:45 +0200 (CEST) Received: from [127.0.0.1] (localhost [127.0.0.1]) by Telcontar.valinor (Postfix) with ESMTP id 536F2324299 for ; Wed, 12 Oct 2022 11:14:45 +0200 (CEST) Message-ID: <8ff56ba7-37d7-dc30-06cb-7fac9dc1f548@telefonica.net> Date: Wed, 12 Oct 2022 11:14:45 +0200 MIME-Version: 1.0 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:102.0) Gecko/20100101 Thunderbird/102.2.2 Content-Language: es-ES, en-CA To: Alpine-info References: <2ba32369-de05-11f5-b448-8d608b946429@gmail.com> <82233959-963d-2d98-4a9b-cb800399c6a@gmail.com> <45E056FD-4901-4845-BD37-D85332D840DC@apple.com> <549935f3-26bb-7d02-f672-dd80b6b54779@telefonica.net> <2e128e1-3597-a49b-2c5e-1fa9b6c62e@gmail.com> From: "Carlos E. R." In-Reply-To: <2e128e1-3597-a49b-2c5e-1fa9b6c62e@gmail.com> X-TnetOut-Country: IP: 79.150.119.218 | Country: ES X-TnetOut-Information: AntiSPAM and AntiVIRUS on relayout02 X-TnetOut-MsgID: 4MnRn21TfRzdZQc.A66B2 X-TnetOut-SpamCheck: no es spam (whitelisted), clean X-TnetOut-From: robin.listas@telefonica.net X-TnetOut-Watermark: 1666170886.30834@9FwcKxr337YGLO6PApdNIQ X-Spam-Status: No X-Proofpoint-Virus-Version: vendor=baseguard engine=ICAP:2.0.205,Aquarius:18.0.895,Hydra:6.0.545,FMLib:17.11.122.1 definitions=2022-10-12_04,2022-10-11_02,2022-06-22_01 X-Proofpoint-Spam-Details: rule=inbound_notspam policy=inbound score=0 adultscore=0 mlxscore=0 mlxlogscore=999 priorityscore=30 clxscore=208 malwarescore=0 lowpriorityscore=0 impostorscore=0 spamscore=0 bulkscore=0 phishscore=0 suspectscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2209130000 definitions=main-2210120060 Subject: Re: [Alpine-info] sending mails with alpine X-BeenThere: alpine-info@u.washington.edu X-Mailman-Version: 2.1.17 Precedence: list List-Id: Alpine Discussion Forum List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Content-Type: multipart/mixed; boundary="===============7467201050181086597==" Errors-To: alpine-info-bounces@mailman12.u.washington.edu Sender: "Alpine-info" X-Proofpoint-GUID: g-wGHo2ohfNKH-u-dUifvsWr994vWQSQ X-Proofpoint-ORIG-GUID: g-wGHo2ohfNKH-u-dUifvsWr994vWQSQ X-Proofpoint-Virus-Version: vendor=baseguard engine=ICAP:2.0.205,Aquarius:18.0.895,Hydra:6.0.545,FMLib:17.11.122.1 definitions=2022-10-12_04,2022-10-11_02,2022-06-22_01 X-Proofpoint-Spam-Details: rule=outbound_notspam policy=outbound score=0 spamscore=0 phishscore=0 priorityscore=1501 bulkscore=0 clxscore=1015 malwarescore=0 impostorscore=0 mlxscore=0 mlxlogscore=999 suspectscore=0 lowpriorityscore=0 adultscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2209130000 definitions=main-2210120060 X-getmail-retrieved-from-mailbox: =?utf-8?q?INBOX?= Status: RO X-Status: X-Keywords: X-UID: 1 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --===============7467201050181086597== Content-Language: es-ES, en-CA Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="------------SqwTSXbMa5xVljrrPn3WFg43" This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --------------SqwTSXbMa5xVljrrPn3WFg43 Content-Type: multipart/mixed; boundary="------------nCfP6rh21u03OFsK7PO1eBUO"; protected-headers="v1" From: "Carlos E. R." To: Alpine-info Message-ID: <8ff56ba7-37d7-dc30-06cb-7fac9dc1f548@telefonica.net> Subject: Re: [Alpine-info] sending mails with alpine References: <2ba32369-de05-11f5-b448-8d608b946429@gmail.com> <82233959-963d-2d98-4a9b-cb800399c6a@gmail.com> <45E056FD-4901-4845-BD37-D85332D840DC@apple.com> <549935f3-26bb-7d02-f672-dd80b6b54779@telefonica.net> <2e128e1-3597-a49b-2c5e-1fa9b6c62e@gmail.com> In-Reply-To: <2e128e1-3597-a49b-2c5e-1fa9b6c62e@gmail.com> --------------nCfP6rh21u03OFsK7PO1eBUO Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: base64 T24gMjAyMi0xMC0xMiAxMDo1NSwgUGllcnJlIEZyZW5raWVsIHdyb3RlOg0KPiB3cm9uZzog SSBoYXZlIG5vIHN1Y2ggcHJvYmxlbSB3aXRoIHRodW5kZXJiaXJkDQoNClllcywgeW91IGhh dmUuIEkgY2FuIHNlZSBpdCBpbiB5b3VyIGhlYWRlcnMuDQoNCkFzIGV2aWRlbmNlZCBoZXJl Og0KDQpYLVRuZXRJbi1TcGFtQ2hlY2s6IG5vIGVzIHNwYW0sIDMsIGNsZWFuIERLSU1fTk9O RSBTUEZfU09GVEZBSUwNCi4gLiAuIC4gLiAuIC4gLiAuIC4gLiAuIC4gLiAuIC4gLiAuIC4g LiAuIC4gLiAuIC4gLioqKioqKioqKioqKioqDQoNCg0KVGhlIHByb2JsZW0gaXMgZXhwbGFp bmVkIGluDQoNCmh0dHBzOi8vZW4ud2lraXBlZGlhLm9yZy93aWtpL1NlbmRlcl9Qb2xpY3lf RnJhbWV3b3JrDQpodHRwczovL2VuLndpa2lwZWRpYS5vcmcvd2lraS9Eb21haW5LZXlzX0lk ZW50aWZpZWRfTWFpbA0KDQogIGNlckBUZWxjb250YXI6fj4gbnNsb29rdXAgLXR5cGU9dHh0 IGdtYWlsLmNvbQ0KU2VydmVyOgkJMTI3LjAuMC4xDQpBZGRyZXNzOgkxMjcuMC4wLjEjNTMN Cg0KTm9uLWF1dGhvcml0YXRpdmUgYW5zd2VyOg0KZ21haWwuY29tCXRleHQgPSANCiJnbG9i YWxzaWduLXNtaW1lLWR2PUNEWVgrWEZIVXcyd21sNi9HYjgrNTlCc0gzMUt6VXI2YzFsMkJQ dnFLWDg9Ig0KZ21haWwuY29tCXRleHQgPSAidj1zcGYxIHJlZGlyZWN0PV9zcGYuZ29vZ2xl LmNvbSINCg0KQXV0aG9yaXRhdGl2ZSBhbnN3ZXJzIGNhbiBiZSBmb3VuZCBmcm9tOg0KDQpj ZXJAVGVsY29udGFyOn4+IG5zbG9va3VwIC10eXBlPXR4dCBfc3BmLmdvb2dsZS5jb20NClNl cnZlcjoJCTEyNy4wLjAuMQ0KQWRkcmVzczoJMTI3LjAuMC4xIzUzDQoNCk5vbi1hdXRob3Jp dGF0aXZlIGFuc3dlcjoNCl9zcGYuZ29vZ2xlLmNvbQl0ZXh0ID0gInY9c3BmMSBpbmNsdWRl Ol9uZXRibG9ja3MuZ29vZ2xlLmNvbSANCmluY2x1ZGU6X25ldGJsb2NrczIuZ29vZ2xlLmNv bSBpbmNsdWRlOl9uZXRibG9ja3MzLmdvb2dsZS5jb20gfmFsbCINCg0KQXV0aG9yaXRhdGl2 ZSBhbnN3ZXJzIGNhbiBiZSBmb3VuZCBmcm9tOg0KDQpjZXJAVGVsY29udGFyOn4+DQoNCg0K DQpTbywgIn5BTEwiLg0KDQpBTEwgIE1hdGNoZXMgYWx3YXlzOyB1c2VkIGZvciBhIGRlZmF1 bHQgcmVzdWx0IGxpa2UgLWFsbCBmb3IgYWxsIElQcyBub3QgDQptYXRjaGVkIGJ5IHByaW9y IG1lY2hhbmlzbXMuDQoNCn4gKHRpbGRlKSBmb3IgU09GVEZBSUwsIGEgZGVidWdnaW5nIGFp ZCBiZXR3ZWVuIE5FVVRSQUwgYW5kIEZBSUwuIA0KVHlwaWNhbGx5LCBtZXNzYWdlcyB0aGF0 IHJldHVybiBhIFNPRlRGQUlMIGFyZSBhY2NlcHRlZCBidXQgdGFnZ2VkLg0KDQoNCldlIGFy ZSBsdWNreSB0aGF0IHRoZXkgYXJlIG5vdCBpbiBlbmZvcmNlIG1vZGUuDQoNCg0KDQoNCj4g QlRXOiBob3cgdG8gdXNlICJnbWFpbCBvd24gc2VydmVycyIgPw0KDQpZb3UgYXJlIHVzaW5n IGZyZWUuZnIgdG8gc2VuZCB0aGlzIGVtYWlsIChzbWFydGhvc3QgY29uZmlndXJhdGlvbiwg DQpwcm9iYWJseSkuIFlvdSBoYXZlIHRvIHVzZSBnbWFpbC5jb20gaW5zdGVhZC4NCg0KLS0g DQpDaGVlcnMgLyBTYWx1ZG9zLA0KDQoJCUNhcmxvcyBFLiBSLg0KCQkoZnJvbSAxNS4zIHg4 Nl82NCBhdCBUZWxjb250YXIpDQoNCg== --------------nCfP6rh21u03OFsK7PO1eBUO-- --------------SqwTSXbMa5xVljrrPn3WFg43 Content-Type: application/pgp-signature; name="OpenPGP_signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="OpenPGP_signature" -----BEGIN PGP SIGNATURE----- wmMEABEIACMWIQQZEb51mJKK1KpcU/W1MxgcbY1H1QUCY0aFhQUDAAAAAAAKCRC1MxgcbY1H1VUS AJ9JpAqAo0e7p7FBGB+x53VgSc/dkQCfXqJQxKPR7fTrOAQAHyaz9ObRL0s= =W8PB -----END PGP SIGNATURE----- --------------SqwTSXbMa5xVljrrPn3WFg43-- --===============7467201050181086597== Content-Type: text/plain; charset="us-ascii" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit Content-Disposition: inline _______________________________________________ Alpine-info mailing list Alpine-info@u.washington.edu http://mailman12.u.washington.edu/mailman/listinfo/alpine-info --===============7467201050181086597==-- From robin.listas at telefonica.net Tue Nov 22 12:55:25 2022 From: robin.listas at telefonica.net (Carlos E. R.) Date: Fri Mar 22 14:17:32 2024 Subject: [Alpine-info] sending mail In-Reply-To: References: Message-ID: <050f870c-b0e9-5918-9945-548d29821317@telefonica.net> -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA1 On Tuesday, 2022-11-22 at 19:18 +0100, Pierre Frenkiel wrote: > when I said that I have no problem with thunderbird, that means that the > mails I send with it actually reach their target! > > It's all what I need. It's generally admitted that when the theory doesn't > match the facts, it's the theory which is wrong. > > don't you agree? When you send an email like this outside of a thread, the entire context is lost. Thus I have no idea what you are talking about. For what is worth, both my Alpine and my Thunderbird pass the email to my postfix, and it is postfix which does the sending. And works in both cases. - -- Cheers, Carlos E. R. (from openSUSE 15.3 x86_64 at Telcontar) -----BEGIN PGP SIGNATURE----- iHoEARECADoWIQQZEb51mJKK1KpcU/W1MxgcbY1H1QUCY303PRwccm9iaW4ubGlz dGFzQHRlbGVmb25pY2EubmV0AAoJELUzGBxtjUfVqe4AnAukzD4LIPAlJAUYd/Dq MxzgYJfVAJ40vkKsZ5EfsmBp9VwpU2uQqgyRVQ== =jQ4u -----END PGP SIGNATURE-----